PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g081270.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 1030aa    MW: 116990 Da    PI: 5.4674
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g081270.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.83.4e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yLk+k+++kk+el ++i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd
  Solyc02g081270.2.1   6 LPPGFRFHPTDEELVAYYLKRKINAKKIEL-DIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKD 95 
                         79****************************.99***************6434555777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s +++ vg+kktLv+y+grap+g +tdWvmheyrl
  Solyc02g081270.2.1  96 RKVNS-QTRSVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                         *****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-624156IPR003441NAC domain
PROSITE profilePS5100560.8276156IPR003441NAC domain
PfamPF023659.7E-307133IPR003441NAC domain
SuperFamilySSF538077.46E-9803987No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1030 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKINA KKIELDIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRSVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDERECEV ANGLQDAYAL CRVIKKNLNT TNGAKIGEQQ YYGNAATSDR  180
SSSVDHVYSH DGGRSCHDMM ESSHGLMPSS SSSTSMAVHG SSPINDNVCA PSEADDDKWM  240
QYLSSNEPNF TFNNSLQPIP NCGTLPFPPS KVDIALECAR LQHRFTLPQL EIQDFPQVGS  300
YADHAKIPAQ SSFIQQASQN HVINQDYSWG GNYNSSCAPN MDDDFSFLIP LNNSNQIHHH  360
GDLGSFNFME QDENVIRSID IGDFDHHDFK SDRMVENLRW IGMSNRDLEK TFLEDYKTVP  420
LENVATVHIE EHELQGENSG HSNSFITGFN ETEANNFSIG FDNFLDNDGD IDGFSNSPSF  480
EVYEKVEVNH GFFIATRQAS KTFYHQVTPS RTLKIHKNLV PLHDFPKSSI NNFVTRPWTT  540
TMRTLVGMVA ILQTFWIYFG ECLELEVKGF KLEDKKGVYE ECCLIEGVEK KIKKVHDFKW  600
DFYEQNKFLI GEKQEEGIKY CCYVEKKWPN YLTLSLDYAN AAIPTVKVGN ISKVGDSAYF  660
RIYYGQTFKV IKNTLDGKSY LLIQNNTRMA SRTKYCTSRI KSFVIPLANY SIETDYFFPV  720
SFFEVRMHSF SIILILLGLL GNLKGITSTY VASQCVLKLY QDGQVESINK TDHQQLAQYA  780
AHFIANTDEA QPCNFATFVP IGEDAPLQRA EWIKYLGVFA NMENRANQVY DAIKENYLCL  840
SKAATGRSSL KPTVSWMEYK DGVWSFTRDP YKLKFVEDAG GVNVDDSINK VTYNMSNPDD  900
LEEIHAILCT VDVVIDETYT SDPAAYNGST FLGNINLEDQ TCFAFLTNQS IWRYDKRVQN  960
SVVLDWYDGA VSQPQLVLAD IVEALYPTGN YNTTYFRNIA KGEGIISIVP EMCERDSSIP  1020
MEPTVVACQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-54213311140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.174120.0flower| leaf| trichome
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265090.0Solanum lycopersicum chromosome 2 clone C02HBa0144P17, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316553.10.0PREDICTED: NAC domain-containing protein 86 isoform X1
TrEMBLK4B9Z70.0K4B9Z7_SOLLC; Uncharacterized protein
STRINGSolyc02g081270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-135NAC domain containing protein 28
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]